PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.XT8UZ
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 365aa    MW: 41646.4 Da    PI: 6.9393
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.XT8UZgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-5381351128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeel+v+yLk+k+++ +l++  +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++++ ++
  Araip.XT8UZ   8 LPPGFRFHPTDEELIVHYLKRKASSAPLPV-AIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPIIASdGQ 104
                  79****************************.88***************8888999*************************************999566 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  +  g+kk Lvfy g+ pkg+kt+W+mheyrl
  Araip.XT8UZ 105 HRLGVKKALVFYGGKPPKGVKTNWIMHEYRL 135
                  779**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.11E-615145IPR003441NAC domain
PROSITE profilePS5100559.0998200IPR003441NAC domain
PfamPF023659.3E-289135IPR003441NAC domain
SuperFamilySSF1019411.11E-61188200IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MDSCQPQLPP GFRFHPTDEE LIVHYLKRKA SSAPLPVAII ADVDLYKFDP WELPSKATFG  60
EQEWYFFSPR DRKYPNGARP NRAATSGYWK ATGTDKPIIA SDGQHRLGVK KALVFYGGKP  120
PKGVKTNWIM HEYRLTTTHN NNSISSSKSF PSLPSHLPSA NNKKNSLRVS IIHFLPTNIF  180
DLDISIKNLD DWVLCRIYEK SNRGNFARTA LMEHHDHDDD DDDNKDQLSA ETTSMIENMS  240
TMSSQNSKPT QHYGPLLVQN DDNFFDGILA ADHHNQQHNL PMKRTLVNMN NSQFWNETNK  300
RFHCDLNNNT NIVANNDEDN TSFVSLLSHN QIPHHPTNNA SLLDPTVADG VFRQHFQLQA  360
INWNL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D3e-69520217170NAC domain-containing protein 19
3swp_C3e-69520217170NAC domain-containing protein 19
3swp_B3e-69520217170NAC domain-containing protein 19
3swp_A3e-69520217170NAC domain-containing protein 19
3swm_D3e-69520217170NAC domain-containing protein 19
3swm_C3e-69520217170NAC domain-containing protein 19
3swm_B3e-69520217170NAC domain-containing protein 19
3swm_A3e-69520217170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150345e-42AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182173.10.0PREDICTED: NAC transcription factor 25-like
TrEMBLA0A0L9TLQ41e-133A0A0L9TLQ4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QZL41e-133A0A0S3QZL4_PHAAN; Uncharacterized protein
STRINGGLYMA07G31220.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.16e-90NAC domain containing protein 25